PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g005237m
Common NameCISIN_1g005237mg, LOC102610953
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 707aa    MW: 78266.6 Da    PI: 5.855
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g005237mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS325.21.3e-993487052374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        +++++++Ae ++ g+  laq +Larl+++ sp  +p+qR+a+y++eAL+  l+          p+ + s +n + +++a+k fse+sPil+f
  orange1.1g005237m 348 IDQIFKAAELIEMGNPVLAQGILARLNHQLSPVVKPFQRAAFYVKEALQLLLHM-----NMNTPSAAMSGYNIIFKISAYKSFSEISPILQF 434
                        67899**********************************************998.....4445777778889******************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakr 185
                        +++t+Nqa+lea+eg++r+HiiDfdi++G+QW++L+q+L  R+egppsl+iT++ s++++++ el  t+e+L++fA+e+++pfe ++l  ++
  orange1.1g005237m 435 ANFTCNQALLEAFEGCNRIHIIDFDIGYGGQWASLMQELVFRSEGPPSLKITAFTSSSTHDEFELGFTQENLKHFASEINIPFELEILSLET 526
                        ***************************************************************************************84443 PP

               GRAS 186 ledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                        l     + L ++   ++++aVnl + +++ +  +++     + vL++vk+l+Pk+vv  ++ +d+ + +F++++++al+ ys l++sl++  
  orange1.1g005237m 527 L-ISASWPLPLQGleNDVTAVNLPIGVFSNY--PATF----PLVLRFVKQLQPKIVVSLDRSCDRPDFPFAHHMVHALQSYSGLLESLDSV- 610
                        3.3345666555555**********998887..4444....55*********************************************654. PP

               GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                          + ++ +k+Er+l+ + i+++v  ++++     e+l  Wr+ ++++GF p+++s++a++qa++l+++++++g++ve+++ slvl+W++++L
  orange1.1g005237m 611 NVNLDALQKIERFLVYPCIEKIVLGRHRS----PERLPPWRSLFMQSGFAPLTFSNFAESQADCLVQRTPVRGFHVEKRQSSLVLCWQRKEL 698
                        3466999*****************99998....9********************************************************** PP

               GRAS 368 vsvSaWr 374
                        +s++aWr
  orange1.1g005237m 699 ISATAWR 705
                        ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.625321685IPR005202Transcription factor GRAS
PfamPF035144.3E-97348705IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MRAMPLAFED FQGKGALDFS SSSSDSRQFH HQQHKEEQDW LLSNSNRGNK KANCCYVGSA  60
TTEPTSVLDN RRSPSPPTSS STLSSSLGGG GSSTTDTTGV AATNASSNPP SVDITNTEKC  120
GGLGMEDWES VLSGSPNQEQ SILRLIMGDT DDPSLGLNKI LHQDTEFNAG FGVVDQASLG  180
FETPFTSVSS NIDPDFVVNS ARLGSVSTQN HIFSMAAATN LSPPPSVFQP QPVEALDEKP  240
QIFRPQLIMN QNQVQYAQNP ALFLPLSYAQ MQEHQLLSPP PPKRLNLGPN QKVPLSDSGQ  300
QELYLRRQQQ QQLQMLQQRQ TMGVTATATK QKMVNDELAN QQLQQAVIDQ IFKAAELIEM  360
GNPVLAQGIL ARLNHQLSPV VKPFQRAAFY VKEALQLLLH MNMNTPSAAM SGYNIIFKIS  420
AYKSFSEISP ILQFANFTCN QALLEAFEGC NRIHIIDFDI GYGGQWASLM QELVFRSEGP  480
PSLKITAFTS SSTHDEFELG FTQENLKHFA SEINIPFELE ILSLETLISA SWPLPLQGLE  540
NDVTAVNLPI GVFSNYPATF PLVLRFVKQL QPKIVVSLDR SCDRPDFPFA HHMVHALQSY  600
SGLLESLDSV NVNLDALQKI ERFLVYPCIE KIVLGRHRSP ERLPPWRSLF MQSGFAPLTF  660
SNFAESQADC LVQRTPVRGF HVEKRQSSLV LCWQRKELIS ATAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2936270518375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ5059570.0GQ505957.1 Citrus trifoliata cultivar Zhi SCL6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006490864.10.0PREDICTED: scarecrow-like protein 6
RefseqXP_006445316.10.0hypothetical protein CICLE_v10019083mg
TrEMBLA0A067H1870.0A0A067H187_CITSI; Uncharacterized protein
TrEMBLV4U8M80.0V4U8M8_9R
STRINGVIT_15s0048g00270.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85742739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-159GRAS family protein